DPH2 anticorps

N° du produit ABIN631965

Cet anticorps anti-DPH2 est un anticorps Lapin Polyclonal détectant DPH2 dans WB. Adapté pour Humain.

Aperçu rapide pour DPH2 anticorps (ABIN631965)

Antigène: DPH2 (Diphthamide Biosynthesis Protein 2 (DPH2))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DPH2 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-DPH2 anticorps

Purification: Affinity purified

Immunogène: DPH2 antibody was raised using a synthetic peptide corresponding to a region with amino acids CLSPPARPLPVAFVLRQRSVALELCVKAFEAQNPDPKAPVVLLSEPACAH

Information d'application

Indications d'application: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

DPH2 Blocking Peptide, (ABIN937132), is also available for use as a blocking control in assays to test for specificity of this DPH2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DPH2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur DPH2

Antigène: DPH2 (Diphthamide Biosynthesis Protein 2 (DPH2))

Autre désignation: DPH2

Sujet: This gene is one of two human genes similar to the yeast gene dph2. The yeast gene was identified by its ability to complement a diphthamide mutant strain, and thus probably functions in diphthamide biosynthesis. Diphthamide is a post-translationally modified histidine residue present in elongation factor 2 (EF2) that is the target of diphtheria toxin ADP-ribosylation. This gene is one of two human genes similar to the yeast gene dph2.

Poids moléculaire: 52 kDa (MW of target protein)